PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.E2LEQ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family EIL
Protein Properties Length: 467aa    MW: 52882.1 Da    PI: 4.842
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.E2LEQgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN380.93.1e-2539111383
                  XXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3   3 lkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkp 83 
                  lkkr wkd++ll+++ke+ k+    +++     +++  +e++r+kkmsraQD++LkYM+k+m+vc+a+GfvYgi+pek++ 
  Araip.E2LEQ  39 LKKRIWKDRVLLQKMKEKFKKD---ESE-----NKEAKQEASRKKKMSRAQDSVLKYMVKIMKVCKARGFVYGIVPEKDES 111
                  89***********999999973...222.....234569***************************************976 PP

2EIN3241.64.4e-74110346129353
                  .XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT.--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHH CS
         EIN3 129 rsseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelg.lskdqgtppykkphdlkkawkvsvLtavikhmsptieeir 225
                  +ss+ h l++lqD+tlgSLLs+lmqhc+ppqrr+pl+kgv+pPWWP+G+e wwg++g l+++qg+ppykkphdlkkawkvsvL++vikhmsp++e++r
  Araip.E2LEQ 110 ESSSIHLLHDLQDATLGSLLSSLMQHCMPPQRRYPLDKGVAPPWWPNGSEVWWGQQGlLAQEQGPPPYKKPHDLKKAWKVSVLASVIKHMSPDLEKLR 207
                  68999****************************************************999************************************** PP

                  HTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX..................XX CS
         EIN3 226 elerqskylqdkmsakesfallsvlnqeekecatvsah.ssslrkqspkvtlsceqkedvegkkeskikhvqavktta..................gf 304
                  +l+ qsk lqd+m+ak+s+++++v+n+ee +++ +  +  +    +  + + ++++ked eg+ e    ++++ +  +                  ++
  Araip.E2LEQ 208 RLVTQSKTLQDRMTAKDSATWSKVVNKEETLLK-LTNKcLK---ISPSSSKDEENNKEDDEGETEVF--ESSSINSINnsldhvlfggggssstgdSE 299
                  ****************************98774.3333122...12222222333333333333332..222222222456788******88654333 PP

                  XXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
         EIN3 305 pvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                  +  +  ++++ +++ v   +  +tcq+  +++s+ +++f dkns+ ++e
  Araip.E2LEQ 300 KRKCNFDSNNNDNSFV--DKLLYTCQNIDCPQSHLSMGFRDKNSRMDHE 346
                  3333333333333333..3679***********************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.5E-2239110No hitNo description
Gene3DG3DSA:1.10.3180.106.7E-66109240IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
PfamPF048733.8E-64111236No hitNo description
SuperFamilySSF1167682.35E-57114238IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MVLIQEEMDP SYVQLTNTED EEIDATLTAE DETIDYEVLK KRIWKDRVLL QKMKEKFKKD  60
ESENKEAKQE ASRKKKMSRA QDSVLKYMVK IMKVCKARGF VYGIVPEKDE SSSIHLLHDL  120
QDATLGSLLS SLMQHCMPPQ RRYPLDKGVA PPWWPNGSEV WWGQQGLLAQ EQGPPPYKKP  180
HDLKKAWKVS VLASVIKHMS PDLEKLRRLV TQSKTLQDRM TAKDSATWSK VVNKEETLLK  240
LTNKCLKISP SSSKDEENNK EDDEGETEVF ESSSINSINN SLDHVLFGGG GSSSTGDSEK  300
RKCNFDSNNN DNSFVDKLLY TCQNIDCPQS HLSMGFRDKN SRMDHESMCA FRSANHQGSN  360
SSNKNSKAFH DYPSSEERMT SVGDWMNMEV AKANNNNNNN NNFGDTDFGD IDIMNGMEEI  420
AGEASGEDNL EDNLELWLND IEDCELLAAL EMVKANSVMD STHQNIP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A8e-601122401128Protein ETHYLENE INSENSITIVE 3
4zds_B8e-601122401128Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015938694.10.0PREDICTED: putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLV7CRS51e-149V7CRS5_PHAVU; Uncharacterized protein
STRINGGLYMA05G31410.11e-143(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65100.12e-90EIL family protein